Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for g_b 31. g_b Lv 1 55 pts. 9,159
  2. Avatar for Jim Fraser 32. Jim Fraser Lv 1 54 pts. 9,149
  3. Avatar for Vredeman 33. Vredeman Lv 1 53 pts. 9,147
  4. Avatar for greepski 34. greepski Lv 1 52 pts. 9,144
  5. Avatar for martin.szew 35. martin.szew Lv 1 51 pts. 9,139
  6. Avatar for SKSbell 36. SKSbell Lv 1 50 pts. 9,138
  7. Avatar for TomTaylor 37. TomTaylor Lv 1 49 pts. 9,132
  8. Avatar for pmdpmd 38. pmdpmd Lv 1 48 pts. 9,126
  9. Avatar for Merf 39. Merf Lv 1 47 pts. 9,123
  10. Avatar for cbwest 40. cbwest Lv 1 46 pts. 9,122

Comments