Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 9 pts. 9,022
  2. Avatar for xkcd 12. xkcd 7 pts. 8,892
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 8,696
  4. Avatar for Natural Abilities 14. Natural Abilities 4 pts. 8,599
  5. Avatar for It's over 9000! 15. It's over 9000! 3 pts. 8,557
  6. Avatar for Deleted group 16. Deleted group pts. 8,489
  7. Avatar for Russian team 17. Russian team 1 pt. 8,374
  8. Avatar for Minions of TWIS 18. Minions of TWIS 1 pt. 8,354
  9. Avatar for Deleted group 19. Deleted group pts. 8,345
  10. Avatar for Czech National Team 20. Czech National Team 1 pt. 8,068
  1. Avatar for WarpSpeed 51. WarpSpeed Lv 1 36 pts. 9,091
  2. Avatar for jamiexq 52. jamiexq Lv 1 35 pts. 9,083
  3. Avatar for goastano 53. goastano Lv 1 34 pts. 9,077
  4. Avatar for sheerbliss 54. sheerbliss Lv 1 33 pts. 9,075
  5. Avatar for Anfinsen_slept_here 55. Anfinsen_slept_here Lv 1 33 pts. 9,071
  6. Avatar for dettingen 56. dettingen Lv 1 32 pts. 9,071
  7. Avatar for harvardman 57. harvardman Lv 1 31 pts. 9,064
  8. Avatar for t012 58. t012 Lv 1 30 pts. 9,058
  9. Avatar for jobo0502 59. jobo0502 Lv 1 30 pts. 9,056
  10. Avatar for viosca 60. viosca Lv 1 29 pts. 9,055

Comments