Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for steveB 91. steveB Lv 1 13 pts. 8,920
  2. Avatar for fishercat 92. fishercat Lv 1 13 pts. 8,915
  3. Avatar for stomjoh 93. stomjoh Lv 1 12 pts. 8,907
  4. Avatar for DaSupaFolda 94. DaSupaFolda Lv 1 12 pts. 8,897
  5. Avatar for fryguy 95. fryguy Lv 1 12 pts. 8,892
  6. Avatar for arginia 96. arginia Lv 1 11 pts. 8,879
  7. Avatar for dbuske 97. dbuske Lv 1 11 pts. 8,879
  8. Avatar for rezaefar 98. rezaefar Lv 1 11 pts. 8,875
  9. Avatar for Exonx 99. Exonx Lv 1 10 pts. 8,871
  10. Avatar for Radeodem8 100. Radeodem8 Lv 1 10 pts. 8,871

Comments