Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for steveB 91. steveB Lv 1 13 pts. 8,920
  2. Avatar for fishercat 92. fishercat Lv 1 13 pts. 8,915
  3. Avatar for stomjoh 93. stomjoh Lv 1 12 pts. 8,907
  4. Avatar for DaSupaFolda 94. DaSupaFolda Lv 1 12 pts. 8,897
  5. Avatar for fryguy 95. fryguy Lv 1 12 pts. 8,892
  6. Avatar for arginia 96. arginia Lv 1 11 pts. 8,879
  7. Avatar for dbuske 97. dbuske Lv 1 11 pts. 8,879
  8. Avatar for rezaefar 98. rezaefar Lv 1 11 pts. 8,875
  9. Avatar for Exonx 99. Exonx Lv 1 10 pts. 8,871
  10. Avatar for Radeodem8 100. Radeodem8 Lv 1 10 pts. 8,871

Comments