Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for reefyrob 41. reefyrob Lv 1 45 pts. 9,120
  2. Avatar for hpaege 42. hpaege Lv 1 44 pts. 9,116
  3. Avatar for actiasluna 43. actiasluna Lv 1 43 pts. 9,110
  4. Avatar for Norrjane 44. Norrjane Lv 1 42 pts. 9,110
  5. Avatar for WonkyDonkey 45. WonkyDonkey Lv 1 41 pts. 9,109
  6. Avatar for mimi 46. mimi Lv 1 40 pts. 9,105
  7. Avatar for shettler 47. shettler Lv 1 39 pts. 9,105
  8. Avatar for froggs554 48. froggs554 Lv 1 38 pts. 9,104
  9. Avatar for cobaltteal 49. cobaltteal Lv 1 37 pts. 9,098
  10. Avatar for silverberg 50. silverberg Lv 1 36 pts. 9,092

Comments