1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Summary

• Created: November 11, 2015
• Expires: November 18, 2015 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

• 1. Anthropic Dreams 100 pts. 9,366
• 2. Go Science 83 pts. 9,328
• 3. Beta Folders 68 pts. 9,318
• 4. Gargleblasters 55 pts. 9,312
• 5. Contenders 44 pts. 9,252
• 6. HMT heritage 35 pts. 9,212
• 7. L'Alliance Francophone 27 pts. 9,211
• 8. Void Crushers 21 pts. 9,191
• 9. Deleted group pts. 9,079
• 10. BOINC@Poland 12 pts. 9,037

Top soloists

• 41. reefyrob 45 pts. 9,120
• 42. hpaege 44 pts. 9,116
• 43. actiasluna 43 pts. 9,110
• 44. Norrjane 42 pts. 9,110
• 45. WonkyDonkey 41 pts. 9,109
• 46. mimi 40 pts. 9,105
• 47. shettler 39 pts. 9,105
• 48. froggs554 38 pts. 9,104
• 49. cobaltteal 37 pts. 9,098
• 50. silverberg 36 pts. 9,092