Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for jermainiac 61. jermainiac Lv 1 28 pts. 9,054
  2. Avatar for WBarme1234 62. WBarme1234 Lv 1 28 pts. 9,053
  3. Avatar for ponderosa 63. ponderosa Lv 1 27 pts. 9,043
  4. Avatar for pvc78 64. pvc78 Lv 1 26 pts. 9,043
  5. Avatar for hansvandenhof 65. hansvandenhof Lv 1 26 pts. 9,042
  6. Avatar for egran48 66. egran48 Lv 1 25 pts. 9,041
  7. Avatar for hada 67. hada Lv 1 24 pts. 9,041
  8. Avatar for Idiotboy 68. Idiotboy Lv 1 24 pts. 9,038
  9. Avatar for kitek314_pl 69. kitek314_pl Lv 1 23 pts. 9,037
  10. Avatar for joremen 70. joremen Lv 1 23 pts. 9,035

Comments