Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037
  1. Avatar for jermainiac 61. jermainiac Lv 1 28 pts. 9,054
  2. Avatar for WBarme1234 62. WBarme1234 Lv 1 28 pts. 9,053
  3. Avatar for ponderosa 63. ponderosa Lv 1 27 pts. 9,043
  4. Avatar for pvc78 64. pvc78 Lv 1 26 pts. 9,043
  5. Avatar for hansvandenhof 65. hansvandenhof Lv 1 26 pts. 9,042
  6. Avatar for egran48 66. egran48 Lv 1 25 pts. 9,041
  7. Avatar for hada 67. hada Lv 1 24 pts. 9,041
  8. Avatar for Idiotboy 68. Idiotboy Lv 1 24 pts. 9,038
  9. Avatar for kitek314_pl 69. kitek314_pl Lv 1 23 pts. 9,037
  10. Avatar for joremen 70. joremen Lv 1 23 pts. 9,035

Comments