Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for 4j rgzh biology 21. 4j rgzh biology 1 pt. 8,047
  2. Avatar for Deleted group 22. Deleted group pts. 7,822
  3. Avatar for CureCoin 23. CureCoin 1 pt. 7,780
  4. Avatar for EricHamber 24. EricHamber 1 pt. 7,733
  5. Avatar for freefolder 25. freefolder 1 pt. 7,553
  6. Avatar for DSN @ Home 26. DSN @ Home 1 pt. 7,345
  7. Avatar for test_group1 27. test_group1 1 pt. 5,718
  1. Avatar for Glen B 71. Glen B Lv 1 22 pts. 9,034
  2. Avatar for gurch 72. gurch Lv 1 22 pts. 9,031
  3. Avatar for Bushman 73. Bushman Lv 1 21 pts. 9,022
  4. Avatar for MaartenDesnouck 74. MaartenDesnouck Lv 1 20 pts. 9,020
  5. Avatar for abiogenesis 75. abiogenesis Lv 1 20 pts. 9,015
  6. Avatar for decbin 76. decbin Lv 1 19 pts. 9,010
  7. Avatar for caglar 77. caglar Lv 1 19 pts. 9,004
  8. Avatar for uhuuhu 78. uhuuhu Lv 1 18 pts. 8,975
  9. Avatar for Iron pet 79. Iron pet Lv 1 18 pts. 8,970
  10. Avatar for Terafold 80. Terafold Lv 1 18 pts. 8,963

Comments