Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037
  1. Avatar for Glen B 71. Glen B Lv 1 22 pts. 9,034
  2. Avatar for gurch 72. gurch Lv 1 22 pts. 9,031
  3. Avatar for Bushman 73. Bushman Lv 1 21 pts. 9,022
  4. Avatar for MaartenDesnouck 74. MaartenDesnouck Lv 1 20 pts. 9,020
  5. Avatar for abiogenesis 75. abiogenesis Lv 1 20 pts. 9,015
  6. Avatar for decbin 76. decbin Lv 1 19 pts. 9,010
  7. Avatar for caglar 77. caglar Lv 1 19 pts. 9,004
  8. Avatar for uhuuhu 78. uhuuhu Lv 1 18 pts. 8,975
  9. Avatar for Iron pet 79. Iron pet Lv 1 18 pts. 8,970
  10. Avatar for Terafold 80. Terafold Lv 1 18 pts. 8,963

Comments