Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for Hiro Protagonist 131. Hiro Protagonist Lv 1 4 pts. 8,696
  2. Avatar for dahast.de 132. dahast.de Lv 1 4 pts. 8,689
  3. Avatar for wudoo 133. wudoo Lv 1 4 pts. 8,689
  4. Avatar for bwkittitas 134. bwkittitas Lv 1 4 pts. 8,689
  5. Avatar for fpc 135. fpc Lv 1 3 pts. 8,686
  6. Avatar for Sydefecks 136. Sydefecks Lv 1 3 pts. 8,682
  7. Avatar for isaksson 137. isaksson Lv 1 3 pts. 8,658
  8. Avatar for Ernst Zundel 138. Ernst Zundel Lv 1 3 pts. 8,651
  9. Avatar for Dantoto 139. Dantoto Lv 1 3 pts. 8,647
  10. Avatar for tela 140. tela Lv 1 3 pts. 8,637

Comments