Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for Truncheon Luncheon 141. Truncheon Luncheon Lv 1 3 pts. 8,630
  2. Avatar for ManVsYard 142. ManVsYard Lv 1 3 pts. 8,629
  3. Avatar for Festering Wounds 143. Festering Wounds Lv 1 3 pts. 8,627
  4. Avatar for guineapig 144. guineapig Lv 1 3 pts. 8,621
  5. Avatar for Mydogisa Toelicker 145. Mydogisa Toelicker Lv 1 2 pts. 8,619
  6. Avatar for Soggy Doglog 146. Soggy Doglog Lv 1 2 pts. 8,612
  7. Avatar for atlas100 147. atlas100 Lv 1 2 pts. 8,605
  8. Avatar for phi16 148. phi16 Lv 1 2 pts. 8,603
  9. Avatar for Simek 149. Simek Lv 1 2 pts. 8,599
  10. Avatar for Mr_Jolty 150. Mr_Jolty Lv 1 2 pts. 8,599

Comments