Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for j.wohlmann 201. j.wohlmann Lv 1 1 pt. 8,042
  2. Avatar for dzSTKI3e 202. dzSTKI3e Lv 1 1 pt. 8,041
  3. Avatar for Close At Hand 203. Close At Hand Lv 1 1 pt. 8,040
  4. Avatar for TYQX 204. TYQX Lv 1 1 pt. 8,040
  5. Avatar for joublot76 205. joublot76 Lv 1 1 pt. 8,028
  6. Avatar for DarkArrow58 206. DarkArrow58 Lv 1 1 pt. 8,016
  7. Avatar for warchou 207. warchou Lv 1 1 pt. 8,003
  8. Avatar for boondog 208. boondog Lv 1 1 pt. 8,002
  9. Avatar for drumpeter18yrs9yrs 209. drumpeter18yrs9yrs Lv 1 1 pt. 7,985
  10. Avatar for kiflo 210. kiflo Lv 1 1 pt. 7,985

Comments