Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for Wrath of Dan 211. Wrath of Dan Lv 1 1 pt. 7,969
  2. Avatar for franse 212. franse Lv 1 1 pt. 7,964
  3. Avatar for 20514392 213. 20514392 Lv 1 1 pt. 7,961
  4. Avatar for akakebeen 214. akakebeen Lv 1 1 pt. 7,959
  5. Avatar for chillprod 215. chillprod Lv 1 1 pt. 7,944
  6. Avatar for akii 216. akii Lv 1 1 pt. 7,940
  7. Avatar for subtlefox 217. subtlefox Lv 1 1 pt. 7,932
  8. Avatar for Carter J. Madsen 218. Carter J. Madsen Lv 1 1 pt. 7,926
  9. Avatar for cnhrcolemam 219. cnhrcolemam Lv 1 1 pt. 7,894
  10. Avatar for SarahSoward 220. SarahSoward Lv 1 1 pt. 7,889

Comments