Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for KiwiLT 231. KiwiLT Lv 1 1 pt. 7,753
  2. Avatar for apn 232. apn Lv 1 1 pt. 7,753
  3. Avatar for sandersen184 233. sandersen184 Lv 1 1 pt. 7,751
  4. Avatar for DarrenChang 234. DarrenChang Lv 1 1 pt. 7,733
  5. Avatar for Chemeng_col 235. Chemeng_col Lv 1 1 pt. 7,707
  6. Avatar for biogeek4 236. biogeek4 Lv 1 1 pt. 7,687
  7. Avatar for harbach 237. harbach Lv 1 1 pt. 7,672
  8. Avatar for BillNye769 238. BillNye769 Lv 1 1 pt. 7,669
  9. Avatar for Nero93 239. Nero93 Lv 1 1 pt. 7,665
  10. Avatar for mirjamvandelft 240. mirjamvandelft Lv 1 1 pt. 7,662

Comments