Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for RobertoTexis 251. RobertoTexis Lv 1 1 pt. 6,991
  2. Avatar for ask4you 252. ask4you Lv 1 1 pt. 6,946
  3. Avatar for Joker7445 253. Joker7445 Lv 1 1 pt. 6,910
  4. Avatar for ldlisenby 254. ldlisenby Lv 1 1 pt. 6,888
  5. Avatar for Luzhanna 255. Luzhanna Lv 1 1 pt. 6,540
  6. Avatar for golivlife 256. golivlife Lv 1 1 pt. 6,326
  7. Avatar for luilat 257. luilat Lv 1 1 pt. 6,297
  8. Avatar for miguelarmenta 258. miguelarmenta Lv 1 1 pt. 6,281
  9. Avatar for lakewik 259. lakewik Lv 1 1 pt. 6,149
  10. Avatar for Tweedle Dumb 260. Tweedle Dumb Lv 1 1 pt. 5,718

Comments