Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037

  1. Avatar for diamond_dust 21. diamond_dust Lv 1 68 pts. 9,198
  2. Avatar for bertro 22. bertro Lv 1 67 pts. 9,196
  3. Avatar for aznarog 23. aznarog Lv 1 65 pts. 9,194
  4. Avatar for Timo van der Laan 24. Timo van der Laan Lv 1 64 pts. 9,191
  5. Avatar for O Seki To 25. O Seki To Lv 1 63 pts. 9,186
  6. Avatar for Deleted player 26. Deleted player pts. 9,183
  7. Avatar for smilingone 27. smilingone Lv 1 60 pts. 9,178
  8. Avatar for nicobul 28. nicobul Lv 1 59 pts. 9,171
  9. Avatar for strong_base 29. strong_base Lv 1 58 pts. 9,165
  10. Avatar for Deleted player 30. Deleted player 57 pts. 9,164

Comments