Placeholder image of a protein
Icon representing a puzzle

1156: Revisiting Puzzle 110: Turkey

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 11, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,366
  2. Avatar for Go Science 2. Go Science 83 pts. 9,328
  3. Avatar for Beta Folders 3. Beta Folders 68 pts. 9,318
  4. Avatar for Gargleblasters 4. Gargleblasters 55 pts. 9,312
  5. Avatar for Contenders 5. Contenders 44 pts. 9,252
  6. Avatar for HMT heritage 6. HMT heritage 35 pts. 9,212
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 27 pts. 9,211
  8. Avatar for Void Crushers 8. Void Crushers 21 pts. 9,191
  9. Avatar for Deleted group 9. Deleted group pts. 9,079
  10. Avatar for BOINC@Poland 10. BOINC@Poland 12 pts. 9,037
  1. Avatar for Petrifolder 121. Petrifolder Lv 1 5 pts. 8,737
  2. Avatar for Vinara 122. Vinara Lv 1 5 pts. 8,734
  3. Avatar for pizpot 123. pizpot Lv 1 5 pts. 8,728
  4. Avatar for TJOK fan 124. TJOK fan Lv 1 5 pts. 8,715
  5. Avatar for ViJay7019 125. ViJay7019 Lv 1 5 pts. 8,712
  6. Avatar for rinze 126. rinze Lv 1 5 pts. 8,709
  7. Avatar for DScott 127. DScott Lv 1 4 pts. 8,704
  8. Avatar for Pro Lapser 128. Pro Lapser Lv 1 4 pts. 8,700
  9. Avatar for manu8170 129. manu8170 Lv 1 4 pts. 8,699
  10. Avatar for GreekCivilization 130. GreekCivilization Lv 1 4 pts. 8,698

Comments