Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,359
  2. Avatar for AST Biology 22. AST Biology 1 pt. 8,336
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,291
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 7,942
  5. Avatar for BiomedSHS 25. BiomedSHS 1 pt. 7,916

  1. Avatar for johngran 151. johngran Lv 1 3 pts. 8,635
  2. Avatar for Exonx 152. Exonx Lv 1 3 pts. 8,633
  3. Avatar for Mike Cassidy 153. Mike Cassidy Lv 1 3 pts. 8,632
  4. Avatar for Mydogisa Toelicker 154. Mydogisa Toelicker Lv 1 2 pts. 8,627
  5. Avatar for DScott 155. DScott Lv 1 2 pts. 8,626
  6. Avatar for Merf 156. Merf Lv 1 2 pts. 8,626
  7. Avatar for armaholik 157. armaholik Lv 1 2 pts. 8,624
  8. Avatar for fishercat 158. fishercat Lv 1 2 pts. 8,624
  9. Avatar for rinze 159. rinze Lv 1 2 pts. 8,621
  10. Avatar for dahast.de 160. dahast.de Lv 1 2 pts. 8,618

Comments