Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,359
  2. Avatar for AST Biology 22. AST Biology 1 pt. 8,336
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,291
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 7,942
  5. Avatar for BiomedSHS 25. BiomedSHS 1 pt. 7,916
  1. Avatar for Tsskyx 161. Tsskyx Lv 1 2 pts. 8,617
  2. Avatar for anderssundin 162. anderssundin Lv 1 2 pts. 8,616
  3. Avatar for bwkittitas 163. bwkittitas Lv 1 2 pts. 8,615
  4. Avatar for JackONeill12 164. JackONeill12 Lv 1 2 pts. 8,613
  5. Avatar for kitek314_pl 165. kitek314_pl Lv 1 2 pts. 8,609
  6. Avatar for Misterioso 166. Misterioso Lv 1 2 pts. 8,608
  7. Avatar for SouperGenious 167. SouperGenious Lv 1 2 pts. 8,607
  8. Avatar for lol3droflxp 168. lol3droflxp Lv 1 2 pts. 8,606
  9. Avatar for rezaefar 169. rezaefar Lv 1 2 pts. 8,603
  10. Avatar for Mr_Jolty 170. Mr_Jolty Lv 1 2 pts. 8,602

Comments