Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,359
  2. Avatar for AST Biology 22. AST Biology 1 pt. 8,336
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,291
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 7,942
  5. Avatar for BiomedSHS 25. BiomedSHS 1 pt. 7,916

  1. Avatar for Hana Hekal 261. Hana Hekal Lv 1 1 pt. 7,663
  2. Avatar for Posiedon2 262. Posiedon2 Lv 1 1 pt. 7,543
  3. Avatar for Vover 263. Vover Lv 1 1 pt. 7,523
  4. Avatar for OokamiJe 264. OokamiJe Lv 1 1 pt. 7,048
  5. Avatar for NachoTGamer 265. NachoTGamer Lv 1 1 pt. 7,022
  6. Avatar for DOREMI91 266. DOREMI91 Lv 1 1 pt. 7,012
  7. Avatar for ArturVS 267. ArturVS Lv 1 1 pt. 7,001
  8. Avatar for CallumGesthuien 268. CallumGesthuien Lv 1 1 pt. 6,240
  9. Avatar for kenny90 269. kenny90 Lv 1 1 pt. 6,230
  10. Avatar for Santor51 270. Santor51 Lv 1 1 pt. 5,923

Comments