Placeholder image of a protein
Icon representing a puzzle

1158: Revisiting Puzzle 111: Mouse

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
November 18, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 8,359
  2. Avatar for AST Biology 22. AST Biology 1 pt. 8,336
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,291
  4. Avatar for SETI.Germany 24. SETI.Germany 1 pt. 7,942
  5. Avatar for BiomedSHS 25. BiomedSHS 1 pt. 7,916

  1. Avatar for WBarme1234 61. WBarme1234 Lv 1 31 pts. 8,806
  2. Avatar for Anfinsen_slept_here 62. Anfinsen_slept_here Lv 1 30 pts. 8,806
  3. Avatar for marie.p 63. marie.p Lv 1 29 pts. 8,805
  4. Avatar for pvc78 64. pvc78 Lv 1 29 pts. 8,801
  5. Avatar for manu8170 65. manu8170 Lv 1 28 pts. 8,799
  6. Avatar for g_b 66. g_b Lv 1 27 pts. 8,798
  7. Avatar for froggs554 67. froggs554 Lv 1 27 pts. 8,798
  8. Avatar for gurch 68. gurch Lv 1 26 pts. 8,797
  9. Avatar for inkycatz 69. inkycatz Lv 1 26 pts. 8,797
  10. Avatar for jamiexq 70. jamiexq Lv 1 25 pts. 8,795

Comments