Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 8,833
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,580
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 4 pts. 8,526
  4. Avatar for SETIKAH@KOREA 14. SETIKAH@KOREA 3 pts. 8,358
  5. Avatar for Natural Abilities 15. Natural Abilities 2 pts. 8,231
  6. Avatar for Deleted group 16. Deleted group pts. 7,695
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,337
  8. Avatar for Deleted group 18. Deleted group pts. 6,522
  9. Avatar for Desert Scientist 19. Desert Scientist 1 pt. 6,518
  10. Avatar for CureCoin 20. CureCoin 1 pt. 5,862
  1. Avatar for Inkedhands 161. Inkedhands Lv 1 2 pts. 8,088
  2. Avatar for jtrube1 162. jtrube1 Lv 1 2 pts. 8,061
  3. Avatar for franse 163. franse Lv 1 2 pts. 8,041
  4. Avatar for AlexsisIV 164. AlexsisIV Lv 1 2 pts. 8,036
  5. Avatar for proteansoup 165. proteansoup Lv 1 2 pts. 8,025
  6. Avatar for Alpha-Cessy 166. Alpha-Cessy Lv 1 2 pts. 8,024
  7. Avatar for johngran 167. johngran Lv 1 2 pts. 8,024
  8. Avatar for finit 168. finit Lv 1 2 pts. 8,022
  9. Avatar for RyeSnake 169. RyeSnake Lv 1 2 pts. 7,975
  10. Avatar for pfirth 170. pfirth Lv 1 2 pts. 7,970

Comments