Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for Inkedhands 161. Inkedhands Lv 1 2 pts. 8,088
  2. Avatar for jtrube1 162. jtrube1 Lv 1 2 pts. 8,061
  3. Avatar for franse 163. franse Lv 1 2 pts. 8,041
  4. Avatar for AlexsisIV 164. AlexsisIV Lv 1 2 pts. 8,036
  5. Avatar for proteansoup 165. proteansoup Lv 1 2 pts. 8,025
  6. Avatar for Alpha-Cessy 166. Alpha-Cessy Lv 1 2 pts. 8,024
  7. Avatar for johngran 167. johngran Lv 1 2 pts. 8,024
  8. Avatar for finit 168. finit Lv 1 2 pts. 8,022
  9. Avatar for RyeSnake 169. RyeSnake Lv 1 2 pts. 7,975
  10. Avatar for pfirth 170. pfirth Lv 1 2 pts. 7,970

Comments