Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 7 pts. 8,833
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,580
  3. Avatar for GUGITBIOTECH 13. GUGITBIOTECH 4 pts. 8,526
  4. Avatar for SETIKAH@KOREA 14. SETIKAH@KOREA 3 pts. 8,358
  5. Avatar for Natural Abilities 15. Natural Abilities 2 pts. 8,231
  6. Avatar for Deleted group 16. Deleted group pts. 7,695
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,337
  8. Avatar for Deleted group 18. Deleted group pts. 6,522
  9. Avatar for Desert Scientist 19. Desert Scientist 1 pt. 6,518
  10. Avatar for CureCoin 20. CureCoin 1 pt. 5,862
  1. Avatar for gmn 31. gmn Lv 1 57 pts. 9,167
  2. Avatar for actiasluna 32. actiasluna Lv 1 56 pts. 9,157
  3. Avatar for grogar7 33. grogar7 Lv 1 55 pts. 9,157
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 54 pts. 9,152
  5. Avatar for Bruno Kestemont 35. Bruno Kestemont Lv 1 53 pts. 9,139
  6. Avatar for Satina 36. Satina Lv 1 52 pts. 9,133
  7. Avatar for mirp 37. mirp Lv 1 51 pts. 9,123
  8. Avatar for pauldunn 38. pauldunn Lv 1 50 pts. 9,122
  9. Avatar for LociOiling 39. LociOiling Lv 1 49 pts. 9,117
  10. Avatar for justjustin 40. justjustin Lv 1 48 pts. 9,101

Comments