Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for gmn 31. gmn Lv 1 57 pts. 9,167
  2. Avatar for actiasluna 32. actiasluna Lv 1 56 pts. 9,157
  3. Avatar for grogar7 33. grogar7 Lv 1 55 pts. 9,157
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 54 pts. 9,152
  5. Avatar for Bruno Kestemont 35. Bruno Kestemont Lv 1 53 pts. 9,139
  6. Avatar for Satina 36. Satina Lv 1 52 pts. 9,133
  7. Avatar for mirp 37. mirp Lv 1 51 pts. 9,123
  8. Avatar for pauldunn 38. pauldunn Lv 1 50 pts. 9,122
  9. Avatar for LociOiling 39. LociOiling Lv 1 49 pts. 9,117
  10. Avatar for justjustin 40. justjustin Lv 1 48 pts. 9,101

Comments