Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for Applied Science - Fold It 23. Applied Science - Fold It 1 pt. 5,130
  4. Avatar for MB109 24. MB109 1 pt. 0
  5. Avatar for Window Group 25. Window Group 1 pt. 0
  1. Avatar for JMStiffler 111. JMStiffler Lv 1 9 pts. 8,576
  2. Avatar for ponderosa 112. ponderosa Lv 1 9 pts. 8,574
  3. Avatar for bonnellap 113. bonnellap Lv 1 8 pts. 8,573
  4. Avatar for t012 114. t012 Lv 1 8 pts. 8,567
  5. Avatar for heather-1 115. heather-1 Lv 1 8 pts. 8,561
  6. Avatar for fpc 116. fpc Lv 1 8 pts. 8,555
  7. Avatar for Pibeagles 117. Pibeagles Lv 1 8 pts. 8,552
  8. Avatar for inkycatz 118. inkycatz Lv 1 7 pts. 8,543
  9. Avatar for abiogenesis 119. abiogenesis Lv 1 7 pts. 8,542
  10. Avatar for Iron pet 120. Iron pet Lv 1 7 pts. 8,534

Comments