Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for JMStiffler 111. JMStiffler Lv 1 9 pts. 8,576
  2. Avatar for ponderosa 112. ponderosa Lv 1 9 pts. 8,574
  3. Avatar for bonnellap 113. bonnellap Lv 1 8 pts. 8,573
  4. Avatar for t012 114. t012 Lv 1 8 pts. 8,567
  5. Avatar for heather-1 115. heather-1 Lv 1 8 pts. 8,561
  6. Avatar for fpc 116. fpc Lv 1 8 pts. 8,555
  7. Avatar for Pibeagles 117. Pibeagles Lv 1 8 pts. 8,552
  8. Avatar for inkycatz 118. inkycatz Lv 1 7 pts. 8,543
  9. Avatar for abiogenesis 119. abiogenesis Lv 1 7 pts. 8,542
  10. Avatar for Iron pet 120. Iron pet Lv 1 7 pts. 8,534

Comments