Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for Applied Science - Fold It 23. Applied Science - Fold It 1 pt. 5,130
  4. Avatar for MB109 24. MB109 1 pt. 0
  5. Avatar for Window Group 25. Window Group 1 pt. 0
  1. Avatar for NameChangeNeeded01 151. NameChangeNeeded01 Lv 1 3 pts. 8,189
  2. Avatar for lightnir 152. lightnir Lv 1 3 pts. 8,186
  3. Avatar for SouperGenious 153. SouperGenious Lv 1 3 pts. 8,179
  4. Avatar for manu8170 154. manu8170 Lv 1 3 pts. 8,175
  5. Avatar for will2216 155. will2216 Lv 1 2 pts. 8,171
  6. Avatar for senor pit 156. senor pit Lv 1 2 pts. 8,154
  7. Avatar for martinf 157. martinf Lv 1 2 pts. 8,139
  8. Avatar for amylindalou 158. amylindalou Lv 1 2 pts. 8,114
  9. Avatar for dahast.de 159. dahast.de Lv 1 2 pts. 8,113
  10. Avatar for Scopper 160. Scopper Lv 1 2 pts. 8,097

Comments