Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850

  1. Avatar for NameChangeNeeded01 151. NameChangeNeeded01 Lv 1 3 pts. 8,189
  2. Avatar for lightnir 152. lightnir Lv 1 3 pts. 8,186
  3. Avatar for SouperGenious 153. SouperGenious Lv 1 3 pts. 8,179
  4. Avatar for manu8170 154. manu8170 Lv 1 3 pts. 8,175
  5. Avatar for will2216 155. will2216 Lv 1 2 pts. 8,171
  6. Avatar for senor pit 156. senor pit Lv 1 2 pts. 8,154
  7. Avatar for martinf 157. martinf Lv 1 2 pts. 8,139
  8. Avatar for amylindalou 158. amylindalou Lv 1 2 pts. 8,114
  9. Avatar for dahast.de 159. dahast.de Lv 1 2 pts. 8,113
  10. Avatar for Scopper 160. Scopper Lv 1 2 pts. 8,097

Comments