Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for Applied Science - Fold It 23. Applied Science - Fold It 1 pt. 5,130
  4. Avatar for MB109 24. MB109 1 pt. 0
  5. Avatar for Window Group 25. Window Group 1 pt. 0
  1. Avatar for rezaefar 171. rezaefar Lv 1 1 pt. 7,950
  2. Avatar for danmorwood 172. danmorwood Lv 1 1 pt. 7,905
  3. Avatar for parsnip 173. parsnip Lv 1 1 pt. 7,887
  4. Avatar for cherry39 174. cherry39 Lv 1 1 pt. 7,880
  5. Avatar for which.chick 175. which.chick Lv 1 1 pt. 7,837
  6. Avatar for momadoc 176. momadoc Lv 1 1 pt. 7,808
  7. Avatar for tzsolti 177. tzsolti Lv 1 1 pt. 7,805
  8. Avatar for kerpowah 178. kerpowah Lv 1 1 pt. 7,795
  9. Avatar for frostschutz 179. frostschutz Lv 1 1 pt. 7,791
  10. Avatar for haustier 180. haustier Lv 1 1 pt. 7,787

Comments