Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for rezaefar 171. rezaefar Lv 1 1 pt. 7,950
  2. Avatar for danmorwood 172. danmorwood Lv 1 1 pt. 7,905
  3. Avatar for parsnip 173. parsnip Lv 1 1 pt. 7,887
  4. Avatar for cherry39 174. cherry39 Lv 1 1 pt. 7,880
  5. Avatar for which.chick 175. which.chick Lv 1 1 pt. 7,837
  6. Avatar for momadoc 176. momadoc Lv 1 1 pt. 7,808
  7. Avatar for tzsolti 177. tzsolti Lv 1 1 pt. 7,805
  8. Avatar for kerpowah 178. kerpowah Lv 1 1 pt. 7,795
  9. Avatar for frostschutz 179. frostschutz Lv 1 1 pt. 7,791
  10. Avatar for haustier 180. haustier Lv 1 1 pt. 7,787

Comments