Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for Applied Science - Fold It 23. Applied Science - Fold It 1 pt. 5,130
  4. Avatar for MB109 24. MB109 1 pt. 0
  5. Avatar for Window Group 25. Window Group 1 pt. 0
  1. Avatar for rinze 181. rinze Lv 1 1 pt. 7,783
  2. Avatar for mirjamvandelft 182. mirjamvandelft Lv 1 1 pt. 7,748
  3. Avatar for Alex333 183. Alex333 Lv 1 1 pt. 7,742
  4. Avatar for Maru67 184. Maru67 Lv 1 1 pt. 7,698
  5. Avatar for Amphimixus 185. Amphimixus Lv 1 1 pt. 7,695
  6. Avatar for Rapture1997 186. Rapture1997 Lv 1 1 pt. 7,687
  7. Avatar for cnhrcolemam 187. cnhrcolemam Lv 1 1 pt. 7,679
  8. Avatar for loutre-waza 188. loutre-waza Lv 1 1 pt. 7,679
  9. Avatar for Tascuz 189. Tascuz Lv 1 1 pt. 7,678
  10. Avatar for trentis1 190. trentis1 Lv 1 1 pt. 7,639

Comments