Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850

  1. Avatar for rinze 181. rinze Lv 1 1 pt. 7,783
  2. Avatar for mirjamvandelft 182. mirjamvandelft Lv 1 1 pt. 7,748
  3. Avatar for Alex333 183. Alex333 Lv 1 1 pt. 7,742
  4. Avatar for Maru67 184. Maru67 Lv 1 1 pt. 7,698
  5. Avatar for Amphimixus 185. Amphimixus Lv 1 1 pt. 7,695
  6. Avatar for Rapture1997 186. Rapture1997 Lv 1 1 pt. 7,687
  7. Avatar for cnhrcolemam 187. cnhrcolemam Lv 1 1 pt. 7,679
  8. Avatar for loutre-waza 188. loutre-waza Lv 1 1 pt. 7,679
  9. Avatar for Tascuz 189. Tascuz Lv 1 1 pt. 7,678
  10. Avatar for trentis1 190. trentis1 Lv 1 1 pt. 7,639

Comments