Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for EVHS AP Biology 21. EVHS AP Biology 1 pt. 5,417
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,339
  3. Avatar for Applied Science - Fold It 23. Applied Science - Fold It 1 pt. 5,130
  4. Avatar for MB109 24. MB109 1 pt. 0
  5. Avatar for Window Group 25. Window Group 1 pt. 0
  1. Avatar for gloverd 11. gloverd Lv 1 84 pts. 9,275
  2. Avatar for pmdpmd 12. pmdpmd Lv 1 82 pts. 9,275
  3. Avatar for nemo7731 13. nemo7731 Lv 1 81 pts. 9,268
  4. Avatar for retiredmichael 14. retiredmichael Lv 1 79 pts. 9,266
  5. Avatar for Museka 15. Museka Lv 1 78 pts. 9,263
  6. Avatar for steveB 16. steveB Lv 1 77 pts. 9,258
  7. Avatar for Skippysk8s 17. Skippysk8s Lv 1 75 pts. 9,255
  8. Avatar for Galaxie 18. Galaxie Lv 1 74 pts. 9,242
  9. Avatar for Crossed Sticks 19. Crossed Sticks Lv 1 72 pts. 9,231
  10. Avatar for nicobul 20. nicobul Lv 1 71 pts. 9,230

Comments