Placeholder image of a protein
Icon representing a puzzle

1162: Unsolved De-novo Freestyle 59

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
November 25, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


HVSEEIERIIREVQEEMKKNKGKGTKLKTSTESDGLRINIEIEVRGDNMRIEVKVKVGNVEVEVRTETSF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,364
  2. Avatar for Contenders 2. Contenders 81 pts. 9,360
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,352
  4. Avatar for Void Crushers 4. Void Crushers 52 pts. 9,318
  5. Avatar for Beta Folders 5. Beta Folders 41 pts. 9,288
  6. Avatar for Go Science 6. Go Science 32 pts. 9,282
  7. Avatar for HMT heritage 7. HMT heritage 24 pts. 9,281
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 18 pts. 9,275
  9. Avatar for Deleted group 9. Deleted group pts. 9,039
  10. Avatar for xkcd 10. xkcd 10 pts. 8,850
  1. Avatar for gloverd 11. gloverd Lv 1 84 pts. 9,275
  2. Avatar for pmdpmd 12. pmdpmd Lv 1 82 pts. 9,275
  3. Avatar for nemo7731 13. nemo7731 Lv 1 81 pts. 9,268
  4. Avatar for retiredmichael 14. retiredmichael Lv 1 79 pts. 9,266
  5. Avatar for Museka 15. Museka Lv 1 78 pts. 9,263
  6. Avatar for steveB 16. steveB Lv 1 77 pts. 9,258
  7. Avatar for Skippysk8s 17. Skippysk8s Lv 1 75 pts. 9,255
  8. Avatar for Galaxie 18. Galaxie Lv 1 74 pts. 9,242
  9. Avatar for Crossed Sticks 19. Crossed Sticks Lv 1 72 pts. 9,231
  10. Avatar for nicobul 20. nicobul Lv 1 71 pts. 9,230

Comments