Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for aldgwarlock04 241. aldgwarlock04 Lv 1 1 pt. 8,193
  2. Avatar for JXPZ 242. JXPZ Lv 1 1 pt. 8,149
  3. Avatar for brgreening 243. brgreening Lv 1 1 pt. 8,125
  4. Avatar for minhcao 244. minhcao Lv 1 1 pt. 8,069
  5. Avatar for aspadistra 245. aspadistra Lv 1 1 pt. 8,058
  6. Avatar for swordofnobody 246. swordofnobody Lv 1 1 pt. 7,858
  7. Avatar for woof689 247. woof689 Lv 1 1 pt. 7,762
  8. Avatar for bkoep 248. bkoep Lv 1 1 pt. 7,713
  9. Avatar for zkm 249. zkm Lv 1 1 pt. 7,685
  10. Avatar for Bailey96 250. Bailey96 Lv 1 1 pt. 7,522

Comments