Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for xkcd 11. xkcd 5 pts. 9,259
  2. Avatar for BOINC@Poland 12. BOINC@Poland 4 pts. 9,222
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 2 pts. 9,108
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,942
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,865
  6. Avatar for Deleted group 16. Deleted group pts. 8,780
  7. Avatar for Applied Science - Fold It 17. Applied Science - Fold It 1 pt. 8,552
  8. Avatar for freefolder 18. freefolder 1 pt. 8,519
  9. Avatar for Deleted group 19. Deleted group pts. 8,469
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,421
  1. Avatar for Mark- 31. Mark- Lv 1 54 pts. 9,450
  2. Avatar for g_b 32. g_b Lv 1 53 pts. 9,450
  3. Avatar for Idiotboy 33. Idiotboy Lv 1 52 pts. 9,446
  4. Avatar for Galaxie 34. Galaxie Lv 1 50 pts. 9,445
  5. Avatar for tarimo 35. tarimo Lv 1 49 pts. 9,444
  6. Avatar for jermainiac 36. jermainiac Lv 1 48 pts. 9,443
  7. Avatar for WarpSpeed 37. WarpSpeed Lv 1 47 pts. 9,442
  8. Avatar for christioanchauvin 38. christioanchauvin Lv 1 46 pts. 9,436
  9. Avatar for johnmitch 39. johnmitch Lv 1 45 pts. 9,432
  10. Avatar for reefyrob 40. reefyrob Lv 1 44 pts. 9,426

Comments