Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,610
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,578
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,554
  4. Avatar for Contenders 4. Contenders 49 pts. 9,546
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,535
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,526
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,500
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 9,468
  9. Avatar for Void Crushers 9. Void Crushers 11 pts. 9,464
  10. Avatar for Deleted group 10. Deleted group pts. 9,373
  1. Avatar for Mark- 31. Mark- Lv 1 54 pts. 9,450
  2. Avatar for g_b 32. g_b Lv 1 53 pts. 9,450
  3. Avatar for Idiotboy 33. Idiotboy Lv 1 52 pts. 9,446
  4. Avatar for Galaxie 34. Galaxie Lv 1 50 pts. 9,445
  5. Avatar for tarimo 35. tarimo Lv 1 49 pts. 9,444
  6. Avatar for jermainiac 36. jermainiac Lv 1 48 pts. 9,443
  7. Avatar for WarpSpeed 37. WarpSpeed Lv 1 47 pts. 9,442
  8. Avatar for christioanchauvin 38. christioanchauvin Lv 1 46 pts. 9,436
  9. Avatar for johnmitch 39. johnmitch Lv 1 45 pts. 9,432
  10. Avatar for reefyrob 40. reefyrob Lv 1 44 pts. 9,426

Comments