Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 8,400
  2. Avatar for Ms. Carter's Jr. Science Classes 22. Ms. Carter's Jr. Science Classes 1 pt. 8,260
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 8,058
  1. Avatar for pmdpmd 51. pmdpmd Lv 1 34 pts. 9,376
  2. Avatar for smilingone 52. smilingone Lv 1 33 pts. 9,376
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 32 pts. 9,373
  4. Avatar for crpainter 54. crpainter Lv 1 32 pts. 9,367
  5. Avatar for stomjoh 55. stomjoh Lv 1 31 pts. 9,366
  6. Avatar for jobo0502 56. jobo0502 Lv 1 30 pts. 9,362
  7. Avatar for TomTaylor 57. TomTaylor Lv 1 29 pts. 9,361
  8. Avatar for marie.p 58. marie.p Lv 1 29 pts. 9,361
  9. Avatar for Superphosphate 59. Superphosphate Lv 1 28 pts. 9,360
  10. Avatar for Paulo Roque 60. Paulo Roque Lv 1 27 pts. 9,357

Comments