Placeholder image of a protein
Icon representing a puzzle

1164: Revisiting Puzzle 113: White Birch

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 02, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 9,610
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,578
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,554
  4. Avatar for Contenders 4. Contenders 49 pts. 9,546
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,535
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,526
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,500
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 15 pts. 9,468
  9. Avatar for Void Crushers 9. Void Crushers 11 pts. 9,464
  10. Avatar for Deleted group 10. Deleted group pts. 9,373

  1. Avatar for pmdpmd 51. pmdpmd Lv 1 34 pts. 9,376
  2. Avatar for smilingone 52. smilingone Lv 1 33 pts. 9,376
  3. Avatar for Anfinsen_slept_here 53. Anfinsen_slept_here Lv 1 32 pts. 9,373
  4. Avatar for crpainter 54. crpainter Lv 1 32 pts. 9,367
  5. Avatar for stomjoh 55. stomjoh Lv 1 31 pts. 9,366
  6. Avatar for jobo0502 56. jobo0502 Lv 1 30 pts. 9,362
  7. Avatar for TomTaylor 57. TomTaylor Lv 1 29 pts. 9,361
  8. Avatar for marie.p 58. marie.p Lv 1 29 pts. 9,361
  9. Avatar for Superphosphate 59. Superphosphate Lv 1 28 pts. 9,360
  10. Avatar for Paulo Roque 60. Paulo Roque Lv 1 27 pts. 9,357

Comments