Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,394
  2. Avatar for LociOiling 2. LociOiling Lv 1 88 pts. 9,393
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 76 pts. 9,391
  4. Avatar for reefyrob 4. reefyrob Lv 1 66 pts. 9,377
  5. Avatar for Deleted player 5. Deleted player pts. 9,376
  6. Avatar for bertro 6. bertro Lv 1 49 pts. 9,360
  7. Avatar for brgreening 7. brgreening Lv 1 42 pts. 9,359
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 36 pts. 9,286
  9. Avatar for gitwut 9. gitwut Lv 1 30 pts. 9,278
  10. Avatar for mimi 10. mimi Lv 1 25 pts. 9,277

Comments