Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,365
  2. Avatar for Deleted player 2. Deleted player pts. 9,269
  3. Avatar for Galaxie 3. Galaxie Lv 1 97 pts. 9,264
  4. Avatar for spvincent 4. spvincent Lv 1 95 pts. 9,257
  5. Avatar for Madde 5. Madde Lv 1 93 pts. 9,254
  6. Avatar for g_b 6. g_b Lv 1 91 pts. 9,248
  7. Avatar for Skippysk8s 7. Skippysk8s Lv 1 89 pts. 9,246
  8. Avatar for nemo7731 8. nemo7731 Lv 1 88 pts. 9,243
  9. Avatar for jermainiac 9. jermainiac Lv 1 86 pts. 9,242
  10. Avatar for LagMasterSam 10. LagMasterSam Lv 1 84 pts. 9,240

Comments