Placeholder image of a protein
Icon representing a puzzle

1165: Unsolved De-novo Freestyle 60

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 03, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


NEEEKIKKRIEEYRKRLSGMRVEIRIGQRVEIEFDGKTELRIHVHRGEEEKIKELLKEIEKVVKN

Top groups


  1. Avatar for Beta Folders 100 pts. 9,394
  2. Avatar for Contenders 2. Contenders 78 pts. 9,286
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 9,266
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 9,254
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,246
  6. Avatar for Go Science 6. Go Science 24 pts. 9,201
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 9,190
  8. Avatar for HMT heritage 8. HMT heritage 12 pts. 9,054
  9. Avatar for xkcd 9. xkcd 8 pts. 8,908
  10. Avatar for Deleted group 10. Deleted group pts. 8,903

  1. Avatar for MaartenDesnouck 91. MaartenDesnouck Lv 1 12 pts. 8,715
  2. Avatar for SKSbell 92. SKSbell Lv 1 12 pts. 8,714
  3. Avatar for Colostomy EXPLOSION. 93. Colostomy EXPLOSION. Lv 1 12 pts. 8,705
  4. Avatar for alwen 94. alwen Lv 1 11 pts. 8,705
  5. Avatar for YGK 95. YGK Lv 1 11 pts. 8,703
  6. Avatar for marie.p 96. marie.p Lv 1 11 pts. 8,687
  7. Avatar for froggs554 97. froggs554 Lv 1 10 pts. 8,683
  8. Avatar for greepski 98. greepski Lv 1 10 pts. 8,682
  9. Avatar for Deleted player 99. Deleted player 10 pts. 8,674
  10. Avatar for andrewxc 100. andrewxc Lv 1 10 pts. 8,655

Comments