Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 10,241
  2. Avatar for Mike Cassidy 2. Mike Cassidy Lv 1 88 pts. 10,232
  3. Avatar for LociOiling 3. LociOiling Lv 1 76 pts. 10,230
  4. Avatar for Deleted player 4. Deleted player 66 pts. 10,229
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 57 pts. 10,226
  6. Avatar for reefyrob 6. reefyrob Lv 1 49 pts. 10,225
  7. Avatar for bertro 7. bertro Lv 1 42 pts. 10,222
  8. Avatar for Deleted player 8. Deleted player pts. 10,220
  9. Avatar for Galaxie 9. Galaxie Lv 1 30 pts. 10,209
  10. Avatar for MaartenDesnouck 10. MaartenDesnouck Lv 1 25 pts. 10,205

Comments