1167: Revisiting Puzzle 114: Black Mamba
Closed since over 10 years ago
Intermediate Overall PredictionSummary
- Created
- December 09, 2015
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK
Top groups
-
1. Beta Folders100 pts. 10,241
-
-
-
-
-
-
-
-
-
-
1. Timo van der Laan Lv 1100 pts. 10,232 -
-
-
-
-
-
-
-
-
Comments