Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for cherry39 131. cherry39 Lv 1 4 pts. 9,041
  2. Avatar for RyeSnake 132. RyeSnake Lv 1 4 pts. 9,035
  3. Avatar for JackONeill12 133. JackONeill12 Lv 1 4 pts. 9,029
  4. Avatar for ViJay7019 134. ViJay7019 Lv 1 4 pts. 9,020
  5. Avatar for Gaouenn 135. Gaouenn Lv 1 4 pts. 9,018
  6. Avatar for Arne Heessels 136. Arne Heessels Lv 1 3 pts. 9,013
  7. Avatar for Inkedhands 137. Inkedhands Lv 1 3 pts. 9,012
  8. Avatar for 01010011111 138. 01010011111 Lv 1 3 pts. 9,005
  9. Avatar for Punktchen 139. Punktchen Lv 1 3 pts. 9,004
  10. Avatar for Scopper 140. Scopper Lv 1 3 pts. 8,990

Comments