Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for franse 141. franse Lv 1 3 pts. 8,984
  2. Avatar for phi16 142. phi16 Lv 1 3 pts. 8,976
  3. Avatar for marie.c 143. marie.c Lv 1 3 pts. 8,956
  4. Avatar for martinf 144. martinf Lv 1 3 pts. 8,949
  5. Avatar for Greenvsemenov 145. Greenvsemenov Lv 1 3 pts. 8,934
  6. Avatar for Maru67 146. Maru67 Lv 1 2 pts. 8,932
  7. Avatar for Quote 147. Quote Lv 1 2 pts. 8,929
  8. Avatar for Marvelz 148. Marvelz Lv 1 2 pts. 8,924
  9. Avatar for pizpot 149. pizpot Lv 1 2 pts. 8,916
  10. Avatar for dettingen 150. dettingen Lv 1 2 pts. 8,913

Comments