Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for NYIT OW BIOL-340 Fall 2015 15. NYIT OW BIOL-340 Fall 2015 1 pt. 8,844
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  7. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  8. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  9. Avatar for Deleted group 19. Deleted group pts. 8,608
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539
  1. Avatar for Swiper 181. Swiper Lv 1 1 pt. 8,724
  2. Avatar for navn 182. navn Lv 1 1 pt. 8,710
  3. Avatar for bcd 183. bcd Lv 1 1 pt. 8,709
  4. Avatar for Tac1 184. Tac1 Lv 1 1 pt. 8,682
  5. Avatar for aspadistra 185. aspadistra Lv 1 1 pt. 8,681
  6. Avatar for momadoc 186. momadoc Lv 1 1 pt. 8,680
  7. Avatar for Wheeler22 187. Wheeler22 Lv 1 1 pt. 8,670
  8. Avatar for smarthuman 188. smarthuman Lv 1 1 pt. 8,656
  9. Avatar for Silhouette 189. Silhouette Lv 1 1 pt. 8,656
  10. Avatar for Kren 190. Kren Lv 1 1 pt. 8,655

Comments