Placeholder image of a protein
Icon representing a puzzle

1167: Revisiting Puzzle 114: Black Mamba

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 09, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,540
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,193
  3. Avatar for Freedom Folders 13. Freedom Folders 2 pts. 8,910
  4. Avatar for xkcd 14. xkcd 1 pt. 8,869
  5. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,681
  6. Avatar for CureCoin 17. CureCoin 1 pt. 8,656
  7. Avatar for EVHS AP Biology 18. EVHS AP Biology 1 pt. 8,644
  8. Avatar for Deleted group 19. Deleted group pts. 8,608
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,539

  1. Avatar for demeter900 211. demeter900 Lv 1 1 pt. 8,552
  2. Avatar for filuis 212. filuis Lv 1 1 pt. 8,541
  3. Avatar for doctaven 213. doctaven Lv 1 1 pt. 8,539
  4. Avatar for Gluonicum 214. Gluonicum Lv 1 1 pt. 8,539
  5. Avatar for kerpowah 215. kerpowah Lv 1 1 pt. 8,534
  6. Avatar for matrizona 216. matrizona Lv 1 1 pt. 8,530
  7. Avatar for prajithparan 217. prajithparan Lv 1 1 pt. 8,510
  8. Avatar for SaDeB2015 218. SaDeB2015 Lv 1 1 pt. 8,509
  9. Avatar for blueispydoesgaming 219. blueispydoesgaming Lv 1 1 pt. 8,506
  10. Avatar for reddoggoo42 220. reddoggoo42 Lv 1 1 pt. 8,502

Comments